PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007267m
Common NameEUTSA_v10007267mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family TALE
Protein Properties Length: 555aa    MW: 61975.4 Da    PI: 6.1688
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007267mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.8e-103854221954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Thhalv10007267m 385 FEHflHPYPKESEKVMLAKQTGLSKNQVANWFINARVR 422
                      554459******************************88 PP

2BELL116.99.8e-38245316172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iS hFr+L+d i+eqi
  Thhalv10007267m 245 ERQELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISCHFRSLRDTIKEQI 316
                      79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-47170314IPR006563POX domain
PfamPF075267.9E-46176312IPR006563POX domain
PROSITE profilePS5007112.487363426IPR001356Homeobox domain
SMARTSM003891.3E-9366430IPR001356Homeobox domain
CDDcd000862.73E-11366427No hitNo description
SuperFamilySSF466892.95E-17367433IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27369432IPR009057Homeodomain-like
PfamPF059201.2E-17383422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MAVYYPSNVN CYQQEPIYLN HQQQQQQQQQ ASSSSAAASF VGDNARNEMV FIPPTTGDVV  60
TNLQNLNGEV AGNGAVSSSD LSFHDGQGLS LSLGTQISVP SFHYHQYQLG FTQNPSISVK  120
ETTPFNVDEI GVKSKEMLLL GQSDPSSGYG GGNGGIGFYN HYRYNEAAGG GFMSSVLRSQ  180
YLKPAQNLLD EVVSVKKELN QMRKKKKGED FNNGSKETEG GGGGGGSAEL SSDSNAKSIE  240
LSITERQELQ NKKNKLLTMV DEVDKRYNQY YHQMEALASS FEIVAGLGSA KPYTSVALNR  300
ISCHFRSLRD TIKEQIQIIR EKLGEKGGES LDEQQGERIP RLRYLDQRLR QQRALHQQLG  360
MVRPAWRPQR GLPENSVSAL RAWLFEHFLH PYPKESEKVM LAKQTGLSKN QVANWFINAR  420
VRLWKPMIEE MYKEEFGGES ELLISKSSQE PNSTNQEDSS SQQQQQESNN NNNNLTYSSA  480
DTTNIGFSSE AKPDRVSGND GEPPQQQQQM NRSADYDTLM NYHGFGLDDY RYIGGNNQQD  540
SRFSNAHHLH DFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15372430563Homeobox protein Meis2
3k2a_B1e-15372430563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3526000.0AK352600.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416473.10.0hypothetical protein EUTSA_v10007267mg
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLE4MVQ30.0E4MVQ3_EUTHA; mRNA, clone: RTFL01-03-C02
TrEMBLV4MSR40.0V4MSR4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10